PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.09G032800.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family SBP
Protein Properties Length: 348aa    MW: 36901.8 Da    PI: 9.3631
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.09G032800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP138.42.1e-4344119176
                          --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                  SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                          +CqvegC++dls+ak y++rhkvC +hsk+p+v+v+gleqrfCqqCsrfh+l efD++krsCrrrLa+hnerrrk+
  Manes.09G032800.2.p  44 RCQVEGCKVDLSDAKAYYSRHKVCGMHSKSPKVTVAGLEQRFCQQCSRFHQLPEFDQGKRSCRRRLAGHNERRRKP 119
                          6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-3537106IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.36842119IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.97E-4143123IPR004333Transcription factor, SBP-box
PfamPF031101.2E-3245118IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
METGSGCLTQ SGAGTPAKSA PGSSSSGSGA PARKVHGGQQ QPPRCQVEGC KVDLSDAKAY  60
YSRHKVCGMH SKSPKVTVAG LEQRFCQQCS RFHQLPEFDQ GKRSCRRRLA GHNERRRKPP  120
PGSVLSSRHS RLSSTIFDNS GRGGGFLVDF SAYSRLNGRD AWPAARSCER APGNQASAAG  180
RSIPHPAWQN NSQNPPSSIY MQGSASGPGF SGSGIPSGEC FTGVSIANSS CALSLLSNQP  240
WGPRNQASGL GMKDLVNPQG VPMAQSTAPH GAAVNQYPNP SWGFKASEAS SSSHDLCPDL  300
GLGQISQPLD SQFSGDLELS QQNTRQYMEL DHTRAYNSST QHMHWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-31451181184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012087743.10.0PREDICTED: squamosa promoter-binding-like protein 9
RefseqXP_012087744.10.0PREDICTED: squamosa promoter-binding-like protein 9
SwissprotQ700W21e-77SPL9_ARATH; Squamosa promoter-binding-like protein 9
TrEMBLB9T2740.0B9T274_RICCO; LIGULELESS1 protein, putative
STRINGVIT_08s0007g06270.t011e-160(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-62squamosa promoter binding protein-like 9